Recovery
VIP
Also known as: Vasoactive intestinal peptide · Aviptadil
Recovery & Repair In stock Box of 10 vials 2 references
28-residue neuropeptide with potent anti-inflammatory and immunoregulatory activity.
Available sizes
| SKU | Per vial | Pack | |
|---|---|---|---|
| VIP5 | 5 mg | 10 vials / box | |
| VIP10 | 10 mg | 10 vials / box |
Order VIP
Pricing is quoted directly and is competitive at every tier — message us with the SKUs you want and quantities for a quote.
Replies within 36 hours. Cryptocurrency (preferred) or card / money-app with a processing fee. COA for this batch available on request.
Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide of the secretin/glucagon family, acting through VPAC1 and VPAC2 receptors on immune, epithelial and smooth-muscle cells.
VIP is described as one of the most potent endogenous anti-inflammatory neuropeptides: it inhibits pro-inflammatory cytokines, promotes regulatory T-cell generation and has shown protective effects in animal models of autoimmune and inflammatory disease 12.
At a glance
- VPAC1/VPAC2 agonist; anti-inflammatory neuropeptide
- Studied in autoimmune, pulmonary and gut-inflammation models
- 5 mg and 10 mg vials
Research use only. All products are sold strictly for laboratory research and development purposes. They are not intended for human or veterinary use, diagnosis, treatment, cure or prevention of any disease. Not for human consumption. Summaries above describe published findings in laboratory and clinical research models and do not constitute claims about this product.
- Form
- Lyophilized powder
- Purity
- HPLC-verified — Certificate of Analysis available on request
- Pack size
- Box of 10 vials
- Storage
- Lyophilized: −20 °C, protected from light (2–8 °C short-term). Reconstituted: 2–8 °C.
- Sequence
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
- Formula
- C147H237N43O43S
- Mol. weight
- 3325.8 g/mol
- CAS No.
- 37221-79-7
Sequence, formula and CAS data are provided for identification. Batch-specific purity, mass-spec and HPLC data are on the Certificate of Analysis — ask for it with your order.
- Delgado M, Ganea D Anti-inflammatory neuropeptides: a new class of endogenous immunoregulatory agents. Brain Behav Immun. 2008;22(8):1146-51.
- Gonzalez-Rey E, Delgado-Maroto V, Souza Moreira L, et al. Neuropeptides as therapeutic approach to autoimmune diseases. Curr Pharm Des. 2010;16(28):3158-72.
Citations retrieved from PubMed (NCBI). Links open the publisher record via DOI and the PubMed abstract.
Related
Often ordered together
Immune
Thymosin Alpha-1
Tα1 · Thymalfasin
28-residue thymic peptide and approved immunomodulator with a comprehensive clinical literature.
5 mg10 mg
Recovery