Immune
Thymosin Alpha-1
Tα1 · Thymalfasin
28-residue thymic peptide and approved immunomodulator with a comprehensive clinical literature.
5 mg10 mg
PNC-27
Also known as: PNC27 · HDM-2-targeting anticancer peptide
Immune & Oncology Research In stock Box of 10 vials 3 references
Membrane-active peptide that selectively lyses cancer cells expressing HDM-2 on the plasma membrane.
Available sizes
| SKU | Per vial | Pack | |
|---|---|---|---|
| PN5 | 5 mg | 10 vials / box | |
| PN10 | 10 mg | 10 vials / box |
Order PNC-27
Pricing is quoted directly and is competitive at every tier — message us with the SKUs you want and quantities for a quote.
Replies within 36 hours. Cryptocurrency (preferred) or card / money-app with a processing fee. COA for this batch available on request.
PNC-27 is a 32-residue peptide combining the p53 HDM-2-binding domain (residues 12–26) with a membrane-residency (penetratin) sequence. Cancer cells express HDM-2 in their plasma membrane; PNC-27 binds it and forms transmembrane pores, causing rapid necrosis of the cancer cell while sparing normal cells lacking membrane HDM-2.
This mechanism — termed 'poptosis' — has been characterised across multiple cancer-cell lines 12; recent work shows PNC-27 kills cervical cancer cells but not normal cervical cells 3.
At a glance
- Selective, HDM-2-directed membrane lysis of cancer cells
- Extensive in-vitro oncology literature (Pincus group)
- 5 mg and 10 mg vials
Research use only. All products are sold strictly for laboratory research and development purposes. They are not intended for human or veterinary use, diagnosis, treatment, cure or prevention of any disease. Not for human consumption. Summaries above describe published findings in laboratory and clinical research models and do not constitute claims about this product.
- Form
- Lyophilized powder
- Purity
- HPLC-verified — Certificate of Analysis available on request
- Pack size
- Box of 10 vials
- Storage
- Lyophilized: −20 °C, protected from light (2–8 °C short-term). Reconstituted: 2–8 °C.
- Sequence
- PPLSQETFSDLWKLL-KKWKMRRNQFWVKVQRG
- Mol. weight
- ~4032 g/mol
Sequence, formula and CAS data are provided for identification. Batch-specific purity, mass-spec and HPLC data are on the Certificate of Analysis — ask for it with your order.
- Pincus MR, Silberstein M, Zohar N, et al. Poptosis or Peptide-Induced Transmembrane Pore Formation: A Novel Way to Kill Cancer Cells without Affecting Normal Cells. Biomedicines. 2024;12(6).
- Krzesaj P, Adler V, Feinman RD, et al. Anti-Cancer Peptide PNC-27 Kills Cancer Cells by Unique Interactions with Plasma Membrane-Bound hdm-2 and with Mitochondrial Membranes Causing Mitochondrial Disruption. Ann Clin Lab Sci. 2024;54(2):137-148.
- Krzesaj PK, Seydafkan S, Miller AI, et al. HDM-2-Targeting Peptide PNC-27 Kills Cervical Cancer Cells but not Normal Cervical Cells. Ann Clin Lab Sci. 2025;55(3):347-353.
Citations retrieved from PubMed (NCBI). Links open the publisher record via DOI and the PubMed abstract.
Related